PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00050238001
Common NameGSBRNA2T00050238001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 198aa    MW: 22197.8 Da    PI: 8.7803
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00050238001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.71.4e-3197153158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RRq+Rakle++++  +ks+kpy+heSRh hA++RpRg+gGrF
  GSBRNA2T00050238001  97 EEPVFVNAKQYHGILRRRQSRAKLEARNRA-IKSKKPYMHESRHLHAINRPRGCGGRF 153
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.3E-3595156IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.13296156IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-2698153IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-2399121IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860101121IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.5E-23130153IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MTSSVHELSD NNESHKKQER PDSQTPPPVP SGPCSESIDT SSVYSEPMAH GLYPYPDPYY  60
RSVFAHQAYL PHPFPGVQMQ LMGMHQQVVP LQCDAVEEPV FVNAKQYHGI LRRRQSRAKL  120
EARNRAIKSK KPYMHESRHL HAINRPRGCG GRFLNAKKKN GDRKEEEEEA TSDENTSEAS  180
SSIRSEKAAM GPNVSRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2096160165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.112901e-66leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00050238001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533790.0AK353379.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-41-M24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009143745.11e-146PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_009143746.11e-146PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ8VY641e-124NFYA4_ARATH; Nuclear transcription factor Y subunit A-4
TrEMBLA0A078H1I01e-146A0A078H1I0_BRANA; BnaA05g09110D protein
TrEMBLM4CMF91e-146M4CMF9_BRARP; Uncharacterized protein
STRINGBra005397.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.11e-111nuclear factor Y, subunit A4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]